General Information

  • ID:  hor000761
  • Uniprot ID:  P23389
  • Protein name:  Secretogranin-1(476-566)
  • Gene name:  CHGB
  • Organism:  Bos taurus (Bovine)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016020 membrane; GO:0030141 secretory granule; GO:0030658 transport vesicle membrane; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  QYAPHHITEKRLGELLNPFYDPSQWKSSRFERKDPMDDSFLEGEEENGLTLNEKNFFPEYNYDWWEKKPFEEDVNWGYEKRNPVPKLDLKR
  • Length:  91(476-566)
  • Propeptide:  MQPAALLGLLGATVVAAVSSMPVDIRNHNEEVVTHCIIEVLSNALLKSSAPPITPECRQVLKKNGKELKNEEKSENENTRFEVRLLRDPADTSEAPGLSSREDSGEGDAQVPTVADTESGGHSRERAGEPPGSQVAKEAKTRYSKSEGQNREEEMVKYQKRERGEVGSEERLSEGPGKAQTAFLNQRNQTPAKKEELVSRYDTQSARGLEKSHSRERSSQESGEETKSQENWPQELQRHPEGQEAPGESEEDASP
  • Signal peptide:  MQPAALLGLLGATVVAAVSS
  • Modification:  T1 Pyrrolidone carboxylic acid;T27 Phosphoserine;T28 Phosphoserine;T39 Phosphoserine;T60 Sulfotyrosine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides. The 16 pairs of basic AA distributed throughout its sequence may be used as proteolytic cleavage sites.; Secretolytin has ant
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P23389-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000761_AF2.pdbhor000761_ESM.pdb

Physical Information

Mass: 1278977 Formula: C510H740N132O152S
Absent amino acids: C Common amino acids: E
pI: 4.65 Basic residues: 16
Polar residues: 22 Hydrophobic residues: 22
Hydrophobicity: -143.74 Boman Index: -27296
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 46.04
Instability Index: 6439.67 Extinction Coefficient cystines: 29450
Absorbance 280nm: 327.22

Literature

  • PubMed ID:  NA
  • Title:  NA